PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016504093.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 357aa    MW: 41069.1 Da    PI: 8.8115
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016504093.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B345.11.8e-141694999
                    HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3  9 dvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                      +k+g l +p  f+ ++ +g k+   +  +  ++g++W vk+  ++++    l++GW +Fv+++gL+ g ++vF+++g++ef   v++f++
  XP_016504093.1 16 PGFKQG-LKIPVGFL-KYlKGYKN---EYAILRKDGKKWLVKV--KGRR----LQEGWGKFVEEQGLELGNMLVFRHEGNMEF--EVTIFDS 94
                    455665.9*******.56554433...5888899*********..7777....*************************99999..9999986 PP

2B348.41.7e-151442181291
                     HTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
              B3  12 ksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                     k g l++p +fa+e+g+ + ++  l+++de+ rsW+++l    + +r+++++ W +F  an+Lk+gD ++F+ + + +++
  XP_016504093.1 144 K-GYLCIPTRFAAENGLTN-KNCGLIIRDERQRSWNLRL--YTSCSRVYIGGSWGDFRVANDLKVGDHIMFEIVTN-GEK 218
                     4.459**********7764.44579**************..889999*************************7764.444 PP

3B351.71.6e-16255337489
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                      ++++++ k++ l+lp +fa ++g+++++  +++l+de +rsW+v l   +   ++ + +GW +F  angL++gD+  F+l+ + +
  XP_016504093.1 255 STIKPYSIKKSVLYLPVDFAISNGLINRK-CEMILKDEANRSWSVWL--GRDAHHFGIISGWTKFRAANGLQVGDVYKFELITNAK 337
                     56789999***************999766.5****************..9999999999*********************987533 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.107.5E-21597IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.083795IPR003340B3 DNA binding domain
SuperFamilySSF1019364.32E-197101IPR015300DNA-binding pseudobarrel domain
CDDcd100174.47E-16893No hitNo description
SMARTSM010194.5E-161095IPR003340B3 DNA binding domain
PfamPF023621.8E-111894IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.8E-16130221IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.75E-16133223IPR015300DNA-binding pseudobarrel domain
SMARTSM010193.8E-8134227IPR003340B3 DNA binding domain
PfamPF023622.7E-13144221IPR003340B3 DNA binding domain
CDDcd100173.59E-14144211No hitNo description
PROSITE profilePS5086310.673149226IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.4E-19247346IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.06E-20247346IPR015300DNA-binding pseudobarrel domain
CDDcd100172.07E-17251344No hitNo description
SMARTSM010195.5E-21252347IPR003340B3 DNA binding domain
PROSITE profilePS5086314.001252346IPR003340B3 DNA binding domain
PfamPF023625.5E-15254341IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MKVTPVKPHF FKPIQPGFKQ GLKIPVGFLK YLKGYKNEYA ILRKDGKKWL VKVKGRRLQE  60
GWGKFVEEQG LELGNMLVFR HEGNMEFEVT IFDSSHCDRE YAEYLDEEEA NNVEFKDKPN  120
AEAATHNACD QSHFSCIVRA YCLKGYLCIP TRFAAENGLT NKNCGLIIRD ERQRSWNLRL  180
YTSCSRVYIG GSWGDFRVAN DLKVGDHIMF EIVTNGEKPI WKFHDIRTKP SDMIPLNAQV  240
STPASGDDDL PYFISTIKPY SIKKSVLYLP VDFAISNGLI NRKCEMILKD EANRSWSVWL  300
GRDAHHFGII SGWTKFRAAN GLQVGDVYKF ELITNAKLPI AYFRRKYSGE DAEREVH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754476e-57HG975447.1 Solanum pennellii chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767536.10.0PREDICTED: B3 domain-containing protein REM10-like
RefseqXP_016504093.10.0PREDICTED: B3 domain-containing protein REM10-like
TrEMBLM1AKH81e-123M1AKH8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000941511e-121(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32215171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.12e-57B3 family protein